Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
50ug |
Host |
Yeast |
Item no. |
CSB-YP762323THZ-50 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Purity |
Greater than 90% as determined by SDS-PAGE. |
Research areas |
others |
Target / Protein |
6GAL |
Biologically active |
Not Test |
Expression system |
Yeast |
Species of origin |
Hypocrea rufa (Trichoderma viride) |
Uniprot ID |
Q76FP5 |
AA Sequence |
DTTLTIDPTSNWGTWEGWGVSLAWWAKAFGNRDDL ASVFFSRNNQAVNGQTLPGLGFNIVRYNAGACSNN SYDGSTMVVSPNIKPSRQMDGFWLDWASSDPSSSS WNWNVDANQRAMLQKAKANGANIFELFSNSPMWWM CNNHNPSGSGSSDNLQSWNYQNHAVYLADIAQHAQ QSWRIQFQSVEAFNEPSSSWWTAEGTQEGCHFDVS TMATVIGYLNTELSSRGLSSFVASSDENTYDLAIS TWQGFNSSTRNIVKRINVHGYQDGGGRRDTLYSLA SQAGKRLWNSEYGDSDASGKSMYQNLLLDFTWLHP TAWVYWQAIDGAGWGLIVGDNDNLTLSSASTKYFV LAQLTRHIRQGMQILTTPDVNTAVAYDAGSQKLVI VTANWGSAQTITFDLTRARTAGSNGATVPRWSTQT GGGDQYRSYTDTKINNGKFSASFSSGQVQTFEVSG VVLQ |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
21-479aa |
Protein length |
Full Length of Mature Protein |
MW |
52.6 kDa |
Relevance |
Hydrolyzes galactooligomers with a degree of polymerization higher than 3. Hydrolyzes radish root arabinogalactan-protein. Does not hydrolyze dextran, arabinan, starch, laminarin, beta-1, 4- and beta-1, 3-galactans, larch wood arabinogalactan or acid-insoluble polygalacturonic acid. |
References |
"Purification and characterization of an endo-beta-(1-->6)-galactanase from Trichoderma viride." Okemoto K., Uekita T., Tsumuraya Y., Hashimoto Y., Kasama T. Carbohydr. Res. 338:219-230(2003) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Hydrolyzes galactooligomers with a degree of polymerization higher than 3. Hydrolyzes radish root arabinogalactan-protein. Does not hydrolyze dextran, arabinan, starch, laminarin, beta-1, 4- and beta-1, 3-galactans, larch wood arabinogalactan or acid-insoluble polygalacturonic acid. |
Protein Families |
Glycosyl hydrolase 5 (cellulase A) family |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.