« Back
Home /
Recombinant Rat Sclerostin domain-containing protein 1(Sostdc1)

Recombinant Rat Sclerostin domain-containing protein 1(Sostdc1)

Item no.	CSB-YP734096RAa4-10
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Signal Transduction
Uniprot ID	Q642G2
Gene Names	Sostdc1
Organism	Rattus norvegicus (Rat)
AA Sequence	FKNDATEILYSHVVKPVSAHPSSNSTLNQARNGGR HFSSTGLDRNSRVQVGCRELRSTKYISDGQCTSIS PLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSS QEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTAC KCKRYTRQHNESSHNFESVSPAKPAQHHRERKRAS KSSKHSLS
Expression Region	24-206aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-sumostar-tagged
MW	36.6 kDa
Alternative Name(s)	Uterine sensitization-associated gene 1 protein Wnt-signaling modulator Usag1, Wise
Relevance	Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner. May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. Enhances Wnt signaling and inhibits TGF-beta signaling.
Reference	"The WNT signalling modulator, Wise, is expressed in an interaction-dependent manner during hair-follicle cycling." O'Shaughnessy R.F.L., Yeo W., Gautier J., Jahoda C.A.B., Christiano A.M. J. Invest. Dermatol. 123:613-621(2004)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner (By similarity). May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. Enhances Wnt signaling and inhibits TGF-beta signaling.
Subcellular Location	Secreted
Protein Families	Sclerostin family
Tissue Specificity	Highly expressed within the maximally sensitized/receptive endometrium. Weakly expressed in brain, kidney and the female reproductive tract. Expressed in the dermal papilla (DP) and at high level in the precortex of both anagen vibrissae and pelage follicles. Dynymic expression during the hair cycle.
Tag Information	N-terminal 6xHis-sumostar-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time