« Back
Home /
Recombinant Mouse Transcription factor MafK(Mafk)

Recombinant Mouse Transcription factor MafK(Mafk)

Manufacturer	Cusabio
Category	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins Neuronal Cell Markers
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	500ug
Item no.	CSB-YP713990MO-500
eClass 6.1	34160400
eClass 9.0	42020190
Available
Purity	Greater than 85% as determined by SDS-PAGE.
Research Areas	Epigenetics and Nuclear Signaling
Uniprot ID	Q61827
Gene Names	Mafk
Organism	Mus musculus (Mouse)
AA Sequence	MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVR ELNQHLRGLTKEEVTRLKQRRRTLKNRGYAASCRI KRVTQKEELERQRVELQQEVEKLARENSSMRLELD ALRSKYEALQTFARTVARGPVTPTKVATTSVITIV KSAELSSTSVPFSAAS
Expression Region	1-156aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	19.5 kDa
Alternative Name(s)	Erythroid transcription factor NF-E2 p18 subunit
Relevance	Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor.
Reference	The ubiquitous subunit of erythroid transcription factor NF-E2 is a small basic-leucine zipper protein related to the v-maf oncogene. Andrews N.C., Kotkow K.J., Ney P.A., Erdjument-Bromage H., Tempst P., Orkin S.H. Proc. Natl. Acad. Sci. U.S.A. 90:11488-11492(1993)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins, such as NFE2, NFE2L1/NRF1, NFE2L2/NRF2 and NFE2L3/NRF3, and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor.
Subcellular Location	Nucleus
Protein Families	BZIP family, Maf subfamily
Tissue Specificity	Highly expressed in heart, skeletal muscle and placenta. Also expressed in erythroid cells.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time