« Back
Home /
Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase(pat)

Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase(pat)

Item no.	CSB-YP701139FOQ-200
Manufacturer	Cusabio
Amount	200ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research areas	Streptomyces viridochromogenes
Target / Protein	pat
Biologically active	Not Test
Expression system	Yeast
Species of origin	Streptomyces viridochromogenes (strain DSM 40736 / JCM 4977 / BCRC 1201 / Tue 494)
Uniprot ID	Q57146
AA Sequence	MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVN FRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAG IAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGST LYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEAL GYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPR PVRPVTQI
Tag Info	N-terminal 6xHis-tagged
Expression Region	1-183aa
Protein length	Full Length
MW	22.6 kDa
Alternative Name(s)	PPT N-acetyltransferase; Phosphinothricin-resistance protein
Relevance	Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance.
References	"Cloning of a phosphinothricin N-acetyltransferase gene from Streptomyces viridochromogenes Tue494 and its expression in Streptomyces lividans and Escherichia coli."Strauch E., Wohlleben W., Puehler A.Gene 63:65-74(1988).
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance.
Protein Families	Acetyltransferase family, PAT/BAR subfamily
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time