« Back
Home /
Recombinant Staphylococcus aureus Clumping factor A(clfA),partial

Recombinant Staphylococcus aureus Clumping factor A(clfA),partial

Item no.	CSB-YP692021FLBb0-500
Manufacturer	Cusabio
Amount	500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Others
Target / Protein	clfA
Biologically Active	Not Test
Expression System	Yeast
Species of origin	Staphylococcus aureus (strain COL)
Uniprot ID	Q5HHM8
AA Sequence	GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGF SVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIM AGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATL TMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVD YEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPS GDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKV DNAADLSESYFVNPENFEDVTNSVNITFPNPNQYK VEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRST LYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPV VPEQPDEPGEIEPIPE
Tag Info	N-terminal 10xHis-tagged
Expression Region	229-559aa
Protein Length	Partial
MW	38.5 kDa
Alternative Name(s)	Fibrinogen receptor A Fibrinogen-binding protein A
Relevance	Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps (By similarity)
Reference	Insights on evolution of virulence and resistance from the complete genome analysis of an early methicillin-resistant Staphylococcus aureus strain and a biofilm-producing methicillin-resistant Staphylococcus epidermidis strain.Gill S.R., Fouts D.E., Archer G.L., Mongodin E.F., DeBoy R.T., Ravel J., Paulsen I.T., Kolonay J.F., Brinkac L.M., Beanan M.J., Dodson R.J., Daugherty S.C., Madupu R., Angiuoli S.V., Durkin A.S., Haft D.H., Vamathevan J.J., Khouri H. Fraser C.M.J. Bacteriol. 187:2426-2438(2005)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps (By similarity).
Subcellular Location	Secreted, cell wall, Peptidoglycan-anchor
Protein Families	Serine-aspartate repeat-containing protein (SDr) family
Tag Information	N-terminal 10xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time