Item no. |
CSB-YP624010HU-100 |
Manufacturer |
Cusabio
|
Amount |
100ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Tat-interacting protein of 110KDA1 Publication,Short name:,Tip1101 Publication,p110 nuclear RNA-binding protein |
Available |
|
Research Areas |
Cancer |
Uniprot ID |
Q15020 |
Gene Names |
SART3 |
Organism |
Homo sapiens (Human) |
AA Sequence |
QRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWG DDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGK CAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSI TVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIF SNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRP MFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLP FSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLA YVEYENESQASQAVMKMDGMTIKENIIKVAISNPP QRKVPEKPETRKAPGGPMLLP |
Expression Region |
600-900aa |
Sequence Info |
Partial |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
35.8 kDa |
Alternative Name(s) |
Tat-interacting protein of 110KDA1 Publication Short name: Tip1101 Publication p110 nuclear RNA-binding protein |
Relevance |
U6 snRNP-binding protein that functions as a recycling factor of the splicing machinery. Promotes the initial reassembly of U4 and U6 snRNPs following their ejection from the spliceosome during its maturation (PubMed:12032085). Also binds U6atac snRNPs and may function as a recycling factor for U4atac/U6atac spliceosomal snRNP, an initial step in the assembly of U12-type spliceosomal complex. The U12-type spliceosomal complex plays a role in the splicing of introns with non-canonical splice sites (PubMed:14749385). May also function as a substrate-targeting factor for deubiquitinases like USP4 and USP15. Recruits USP4 to ubiquitinated PRPF3 within the U4/U5/U6 tri-snRNP complex, promoting PRPF3 deubiquitination and thereby regulating the spliceosome U4/U5/U6 tri-snRNP spliceosomal complex disassembly (PubMed:20595234). May also recruit the deubiquitinase USP15 to histone H2B and mediate histone deubiquitination, thereby regulating gene expression and/or DNA repair (PubMed:24526689). May play a role in hematopoiesis probably through transcription regulation of specific genes including MYC (By similarity).By similarity4 Publications Regulates Tat transactivation activity through direct interaction. May be a cellular factor for HIV-1 gene expression and viral replication. |
Reference |
The finished DNA sequence of human chromosome 12.Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
U6 snRNP-binding protein that functions as a recycling factor of the splicing machinery. Promotes the initial reassembly of U4 and U6 snRNPs following their ejection from the spliceosome during its maturation |
Subcellular Location |
Nucleus, nucleoplasm, Nucleus, Cajal body, Nucleus speckle, Cytoplasm |
Tissue Specificity |
Ubiquitously expressed. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.