« Back
Home /
Recombinant Human Guanylate cyclase activator 2B(GUCA2B)

Recombinant Human Guanylate cyclase activator 2B(GUCA2B)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	Yeast
Item no.	CSB-YP613693HU-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Alias	Guanylate cyclase C-activating peptide II ;GCAP-IIUroguanylin ;UGN
Purity	Greater than 90% as determined by SDS-PAGE.
Research Topic	Signal Transduction
Uniprot ID	Q16661
Gene Names	GUCA2B
Organism	Homo sapiens (Human)
AA Sequence	VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQS LLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIA NDDCELCVNVACTGCL
Expression Region	27-112aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	11.5 kDa
Alternative Name(s)	Guanylate cyclase C-activating peptide II ; GCAP-IIUroguanylin ; UGN
Relevance	Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
Reference	Cloning and characterization of a cDNA encoding a precursor for human uroguanylin.Miyazato M., Nakazato M., Yamaguchi H., Date Y., Kojima M., Kangawa K., Matsuo H., Matsukura S.Biochem. Biophys. Res. Commun. 219:644-648(1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
Subcellular Location	Secreted
Protein Families	Guanylin family
Tissue Specificity	Stomach and intestine.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time