Item no. |
CSB-YP518830HU-1 |
Manufacturer |
Cusabio
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research areas |
Cancer |
Target / Protein |
PODXL |
Biologically active |
Not Test |
Expression system |
Yeast |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
O00592 |
AA Sequence |
QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTV PTSKANEILASVKATTLGVSSDSPGTTTLAQQVSG PVNTTVARGGGSGNPTTTIESPKSTKSADTTTVAT STATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLT STKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGH DHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFH HVSQAGLELLTSGDLPTLASQSAGITASSVISQRT QQTSSQMPASSTAPSSQETVQPTSPATALRTPTLP ETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCED LETQTQSEKQLVLNLTGNTLCAGGASDEKLISLIC RAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIH TKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPP EEAEDRF |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
32-458aa |
Protein length |
Partial |
MW |
46.2 kDa |
Alternative Name(s) |
GCTM-2 antigen; Gp200Podocalyxin-like protein 1 ; PC ; PCLP-1 |
Relevance |
Involved in the regulation of both adhesion and cell morphology and cancer progression. Function as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma mbrane subdomain to set up inital epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells. |
References |
Molecular cloning and characterization of human podocalyxin-like protein. Orthologous relationship to rabbit PCLP1 and rat podocalyxin.Kershaw D.B., Beck S.G., Wharram B.L., Wiggins J.E., Goyal M., Thomas P.E., Wiggins R.C.J. Biol. Chem. 272:15708-15714(1997) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Involved in the regulation of both adhesion and cell morphology and cancer progression. Function as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up inital epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells. |
Subcellular Location |
Apical cell membrane, Cell projection, lamellipodium, Cell projection, filopodium, Cell projection, ruffle, Cell projection, microvillus, Membrane raft, Membrane, Single-pass type I membrane protein |
Protein Families |
Podocalyxin family |
Tissue Specificity |
Glomerular epithelium cell (podocyte). |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.