« Back
Home /
Recombinant Bovine Odorant-binding protein

Recombinant Bovine Odorant-binding protein

Item no.	CSB-YP362133BOa0-100
Manufacturer	Cusabio
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Others
Uniprot ID	P07435
Gene Names	N/A
Organism	Bos taurus (Bovine)
AA Sequence	AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGP FRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVK ATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNIN VDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKG IDKKNVVNFLENEDHPHPE
Expression Region	1-159aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	20.5 kDa
Alternative Name(s)	Olfactory mucosa pyrazine-binding protein
Relevance	This protein binds a wide variety of chemical odorants.
Reference	Three-dimensional structure and active site of three hydrophobic molecule-binding proteins with significant amino acid sequence similarity. Monaco H.L., Zanotti G. Biopolymers 32:457-465(1992)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	This protein binds a wide variety of chemical odorants.
Subcellular Location	Secreted
Protein Families	Calycin superfamily, Lipocalin family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time