« Back
Home /
Recombinant Mouse Major urinary proteins 11 and 8(Mup11)

Recombinant Mouse Major urinary proteins 11 and 8(Mup11)

Item no.	CSB-YP361419MO-1
Manufacturer	Cusabio
Amount	1mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	MUP11 and MUP8
Available
Research Areas	Others
Uniprot ID	P04938
Gene Names	Mup11
Organism	Mus musculus (Mouse)
AA Sequence	REKINGEWHTIILASDKREKIEDNGNFRLFLEQIH VLENSLVLKFHTVRDEECSELSMVADKTEKAGEYS VTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQL MGLYGREPDLSSDIKERFAQLCEEHGILRENIIDL SNANRCLQARE
Expression Region	1-151aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	19.6 kDa
Alternative Name(s)	MUP11 and MUP8
Relevance	Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales.
Reference	Analysis of mouse major urinary protein genes variation between the exonic sequences of group 1 genes and a comparison with an active gene out with group 1 both suggest that gene conversion has occurred between MUP genes.Clark A.J., Chave-Cox A., Ma X., Bishop J.O.EMBO J. 4:3167-3171(1985)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Major urinary proteins (Mups) bind pheromones, and thus stabilize them to allow slow release into the air from urine marks. May protect pheromones from oxidation. May also act as pheromones themselves. In this context, they play a role in the regulation of social behaviors, such as aggression, mating, pup-suckling, territory establishment and dominance (Probable). Binds the pheromone analog 2-sec-butyl-4, 5-dihydrothiazole (SBT) in vitro
Subcellular Location	Secreted
Protein Families	Calycin superfamily, Lipocalin family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP361419MO-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time