« Back
Home /
Recombinant Chicken Riboflavin-binding protein,partial

Recombinant Chicken Riboflavin-binding protein,partial

Item no.	CSB-YP360879CH-50
Manufacturer	Cusabio
Amount	50ug
Category	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Others
Uniprot ID	P02752
Gene Names	N/A
Organism	Gallus gallus (Chicken)
AA Sequence	QQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYA NFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKK IECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDD WYEACKDDSICAHNWLTDWERDESGENHCKSKCVP YSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKK DMVAIKHLLSESSEESSSMSSSEEHACQKKLLK
Expression Region	18-225aa
Sequence Info	Partial
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	25.8 kDa
Relevance	Required for the transport of riboflavin to the developing oocyte.
Reference	Chicken riboflavin-binding protein. cDNA sequence and homology with milk folate-binding protein.Zheng D.B., Lim H.M., Pene J.J., White H.B. IIIJ. Biol. Chem. 263:11126-11129(1988)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required for the transport of riboflavin to the developing oocyte.
Protein Families	Folate receptor family
Tissue Specificity	Yolk RBP is synthesized in the liver; egg-white RBP is synthesized in the oviduct.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time