Item no. |
CSB-YP360879CH-50 |
Manufacturer |
Cusabio
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Topic |
Others |
Uniprot ID |
P02752 |
Gene Names |
N/A |
Organism |
Gallus gallus (Chicken) |
AA Sequence |
QQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYA NFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKK IECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDD WYEACKDDSICAHNWLTDWERDESGENHCKSKCVP YSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKK DMVAIKHLLSESSEESSSMSSSEEHACQKKLLK |
Expression Region |
18-225aa |
Sequence Info |
Partial |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
25.8 kDa |
Relevance |
Required for the transport of riboflavin to the developing oocyte. |
Reference |
Chicken riboflavin-binding protein. cDNA sequence and homology with milk folate-binding protein.Zheng D.B., Lim H.M., Pene J.J., White H.B. IIIJ. Biol. Chem. 263:11126-11129(1988) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Required for the transport of riboflavin to the developing oocyte. |
Protein Families |
Folate receptor family |
Tissue Specificity |
Yolk RBP is synthesized in the liver; egg-white RBP is synthesized in the oviduct. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.