Item no. |
CSB-YP356317IDG-1 |
Manufacturer |
Cusabio
|
Amount |
1mg |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Topic |
Microbiology |
Uniprot ID |
P04664 |
Gene Names |
HA |
Organism |
Influenza A virus (strain A/England/878/1969 H3N2) |
AA Sequence |
QDLPGNDNSTATLCLGHHAVPNGTLVKTITNDQIE VTNATELVQSSSTGKICNNPHRILDGINCTLIDAL LGDPHCDVFQDETWDLFVERSKAFSNCYPYDVPDY ASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACK RGPDSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFD KLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQ QTIIPNIGSRPWVRGLSSRISIYWTIVKPGDVLVI NSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISE CITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLK LATGMRNVPEKQT |
Expression Region |
1-328aa |
Sequence Info |
Full Length |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
38.1 kDa |
Relevance |
Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization of about two third of the virus particles through clathrin-dependent endocytosis and about one third through a clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore. |
Reference |
"Antigenic drift in the hemagglutinin of the Hong Kong influenza subtype: correlation of amino acid changes with alterations in viral antigenicity." Sleigh M.J., Both G.W., Underwood P.A., Bender V.J. J. Virol. 37:845-853(1981) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization of about two third of the virus particles through clathrin-dependent endocytosis and about one third through a clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore. |
Subcellular Location |
Virion membrane, Single-pass type I membrane protein, Host apical cell membrane, Single-pass type I membrane protein |
Protein Families |
Influenza viruses hemagglutinin family |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.