Item no. |
CSB-YP355908ENV-1 |
Manufacturer |
Cusabio
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Serine chemoreceptor protein |
Available |
|
Research Topic |
Others |
Uniprot ID |
P02942 |
Gene Names |
tsr |
Organism |
Escherichia coli (strain K12) |
AA Sequence |
WFGIKASLVAPMNRLIDSIRHIAGGDLVKPIEVDG SNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSG ASEIATGNNDLSSRTEQQAASLEETAASMEQLTAT VKQNAENARQASHLALSASETAQRGGKVVDNVVQT MRDISTSSQKIADIISVIDGIAFQTNILALNAAVE AARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSL IEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDI MGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAAL VEESAAAAAALEEQASRLTEAVAVFRIQQQQRETS AVVKTVTPAAPRKMAVADSEENWETF |
Expression Region |
211-551aa |
Sequence Info |
Cytoplasmic Domain |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
38 kDa |
Alternative Name(s) |
Serine chemoreceptor protein |
Relevance |
Receptor for the attractant L-serine and related amino acids. Is also responsible for chotaxis away from a wide range of repellents, including leucine, indole, and weak acids.Chotactic-signal transducers respond to changes in the concentration of attractants and repellents in the environment, transduce a signal from the outside to the inside of the cell, and facilitate sensory adaptation through the variation of the level of methylation. Attractants increase the level of methylation while repellents decrease the level of methylation, the methyl groups are added by the methyltransferase CheR and roved by the methylesterase CheB. |
Reference |
Escherichia coli proteome analysis using the gene-protein database.VanBogelen R.A., Abshire K.Z., Moldover B., Olson E.R., Neidhardt F.C.Electrophoresis 18:1243-1251(1997) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Receptor for the attractant L-serine and related amino acids. Is also responsible for chemotaxis away from a wide range of repellents, including leucine, indole, and weak acids.; FUNCTION |
Subcellular Location |
Cell inner membrane, Multi-pass membrane protein |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.