« Back
Home /
Recombinant Mycobacterium tuberculosis Steroid C26-monooxygenase(cyp125)

Recombinant Mycobacterium tuberculosis Steroid C26-monooxygenase(cyp125)

Item no.	CSB-YP351308MVZ-10
Manufacturer	Cusabio
Amount	10ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cholest-4-en-3-one 26-monooxygenaseCytochrome P450 125Steroid C27-monooxygenase
Available
Research Topic	Others
Uniprot ID	P9WPP1
Gene Names	cyp125
Organism	Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
AA Sequence	MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYA ERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGF WAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIA REDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAV GRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELP LQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAH IDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQ ADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQG MMAFAEHPDQWELYKKVRPETAADEIVRWATPVTA FQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEV FQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARM TINLIFNAVADHMPDLKPISAPERLRSGWLNGIKH WQVDYTGRCPVAH
Expression Region	1-433aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	50.4 kDa
Alternative Name(s)	Cholest-4-en-3-one 26-monooxygenaseCytochrome P450 125Steroid C27-monooxygenase
Relevance	Catalyzes the C-27 hydroxylation of cholest-4-en-3-one and cholesterol and subsequently oxidizes the alcohol of the former to the cholest-4-en-3-one-27-oic acid via the aldehyde intermediate. Not required to incorporate the cholesterol side-chain carbon atoms into cellular lipids.
Reference	Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.Cole S.T., Brosch R., Parkhill J., Garnier T., Churcher C.M., Harris D.E., Gordon S.V., Eiglmeier K., Gas S., Barry C.E. III, Tekaia F., Badcock K., Basham D., Brown D., Chillingworth T., Connor R., Davies R.M., Devlin K. , Feltwell T., Gentles S., Hamlin N., Holroyd S., Hornsby T., Jagels K., Krogh A., McLean J., Moule S., Murphy L.D., Oliver S., Osborne J., Quail M.A., Rajandream M.A., Rogers J., Rutter S., Seeger K., Skelton S., Squares S., Squares R., Sulston J.E., Taylor K., Whitehead S., Barrell B.G.Nature 393:537-544(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in the utilization of cholesterol as the sole carbon and energy source by degrading the side chain during infection
Protein Families	Cytochrome P450 family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP351308MVZ-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time