« Back
Home /
Recombinant Toxocara canis 26KDA secreted antigen(TES-26)

Recombinant Toxocara canis 26KDA secreted antigen(TES-26)

Item no.	CSB-YP347478THA-1
Manufacturer	Cusabio
Amount	1mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Toxocara excretory-secretory antigen 26 ;TES-26
Available
Research areas	Others
Target / Protein	TES-26
Biologically active	Not Test
Expression system	Yeast
Species of origin	Toxocara canis (Canine roundworm)
Uniprot ID	P54190
AA Sequence	QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNT CDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCG LCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQV NCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPD FPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQ PSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQ DSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Tag Info	N-terminal 6xHis-tagged
Expression Region	22-262aa
Protein length	Full Length of Mature Protein
MW	27.9 kDa
Alternative Name(s)	Toxocara excretory-secretory antigen 26 ; TES-26
Relevance	Binds phosphatidylethanolamine.
References	An abundant, trans-spliced mRNA from Toxocara canis infective larvae encodes a 26-kDa protein with homology to phosphatidylethanolamine-binding proteins.Gems D., Ferguson C.J., Robertson B.D., Nieves R., Page A.P., Blaxter M.L., Maizels R.M.J. Biol. Chem. 270:18517-18522(1995)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds phosphatidylethanolamine.
Subcellular Location	Secreted
Protein Families	Phosphatidylethanolamine-binding protein family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP347478THA-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time