« Back
Home /
Recombinant Apium graveolens Major allergen Api g 1, isoallergen 1

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 1

Item no.	CSB-YP342610DNL-10
Manufacturer	Cusabio
Amount	10ug
Category	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Allergen Api g 1.0101,Allergen Api g I,Allergen: Api g 1
Available
Research Topic	Allergen
Uniprot ID	P49372
Gene Names	N/A
Organism	Apium graveolens (Celery)
AA Sequence	MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAA PGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLR IDGVNKEALTFDYSVIDGDILLGFIESIENHVVLV PTADGGSICKTTAIFHTKGDAVVPEENIKYANEQN TALFKALEAYLIAN
Expression Region	1-154aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	18.3 kDa
Alternative Name(s)	Allergen Api g 1.0101 Allergen Api g I Allergen: Api g 1
Reference	"Crystal structure of the major celery allergen Api g 1: molecular analysis of cross-reactivity."Schirmer T., Hoffimann-Sommergrube K., Susani M., Breiteneder H., Markovic-Housley Z.J. Mol. Biol. 351:1101-1109(2005)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Protein Families	BetVI family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time