Item no. |
CSB-YP336542DOA-500 |
Manufacturer |
Cusabio
|
Amount |
500ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
Mouse |
Host |
Yeast |
Conjugate/Tag |
Myc |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Nucleoside diphosphate kinase I,Short name:NDK I,Short name:NDP kinase I,Short name:NDPK I |
Available |
|
Research Areas |
Others |
Target / Protein |
NDK1 |
Biologically Active |
Not Test |
Expression System |
Yeast |
Species of origin |
Arabidopsis thaliana (Mouse-ear cress) |
Uniprot ID |
P39207 |
AA Sequence |
MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGL KLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPV VAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDF AIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQS SVHPWVYET |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Expression Region |
1-149aa |
Protein Length |
Full Length |
MW |
20.5 kDa |
Alternative Name(s) |
Nucleoside diphosphate kinase I Short name:NDK I Short name:NDP kinase I Short name:NDPK I |
Relevance |
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress. |
Reference |
Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana.Mayer K.F.X., Schueller C., Wambutt R., Murphy G., Volckaert G., Pohl T., Duesterhoeft A., Stiekema W., Entian K.-D., Terryn N., Harris B., Ansorge W., Brandt P., Grivell L.A., Rieger M., Weichselgartner M., de Simone V., Obermaier B. McCombie W.R.Nature 402:769-777(1999) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress. |
Subcellular Location |
Peroxisome, Nucleus, Cytoplasm |
Protein Families |
NDK family |
Tag Information |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.