Comparison

Recombinant Arabidopsis thaliana Nucleoside diphosphate kinase 1(NDK1)

Item no. CSB-YP336542DOA-100
Manufacturer Cusabio
Amount 100ug
Quantity options 1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Mouse
Host Yeast
Conjugate/Tag Myc
Purity Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Nucleoside diphosphate kinase I,Short name:NDK I,Short name:NDP kinase I,Short name:NDPK I
Available
Research Areas
Others
Target / Protein
NDK1
Biologically Active
Not Test
Expression System
Yeast
Species of origin
Arabidopsis thaliana (Mouse-ear cress)
Uniprot ID
P39207
AA Sequence
MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGL KLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPV VAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDF AIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQS SVHPWVYET
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region
1-149aa
Protein Length
Full Length
MW
20.5 kDa
Alternative Name(s)
Nucleoside diphosphate kinase I
Short name:NDK I
Short name:NDP kinase I
Short name:NDPK I
Relevance
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress.
Reference
Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana.Mayer K.F.X., Schueller C., Wambutt R., Murphy G., Volckaert G., Pohl T., Duesterhoeft A., Stiekema W., Entian K.-D., Terryn N., Harris B., Ansorge W., Brandt P., Grivell L.A., Rieger M., Weichselgartner M., de Simone V., Obermaier B. McCombie W.R.Nature 402:769-777(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress.
Subcellular Location
Peroxisome, Nucleus, Cytoplasm
Protein Families
NDK family
Tag Information
N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close