« Back
Home /
Recombinant Rat Regenerating islet-derived protein 3-beta(Reg3b)

Recombinant Rat Regenerating islet-derived protein 3-beta(Reg3b)

Item no.	CSB-YP326510RA-1
Manufacturer	Cusabio
Amount	1mg
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Others
Uniprot ID	P25031
Gene Names	Reg3b
Organism	Rattus norvegicus (Rat)
AA Sequence	EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTW FDAELACQKRPEGHLVSVLNVAEASFLASMVKNTG NSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYV NWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVK LPYVCKFTG
Expression Region	27-175aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-sumostar-tagged
MW	32.6 kDa
Alternative Name(s)	Pancreatitis-associated protein 1; Peptide 23REG-2Regenerating islet-derived protein III-beta ; Reg III-beta
Relevance	Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues .
Reference	Messenger RNA sequence and expression of rat pancreatitis-associated protein, a lectin-related protein overexpressed during acute experimental pancreatitis.Iovanna J., Orelle B., Keim V., Dagorn J.-C.J. Biol. Chem. 266:24664-24669(1991)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues (By similarity).
Involvement in disease	Overexpressed during the acute phase of pancreatitis.
Subcellular Location	Secreted
Tissue Specificity	Constitutively expressed in intestine.
Tag Information	N-terminal 6xHis-sumostar-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time