« Back
Home /
Recombinant Salmonella typhi 3-dehydroquinate dehydratase(aroD)

Recombinant Salmonella typhi 3-dehydroquinate dehydratase(aroD)

Item no.	CSB-YP326162SWW-10
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Type I DHQase
Available
Research areas	Others
Target / Protein	aroD
Biologically active	Not Test
Expression system	Yeast
Species of origin	Salmonella typhi
Uniprot ID	P24670
AA Sequence	MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEAL AYREATFDILEWRVDHFMDIASTQSVLTAARVIRD AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAI DSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVM SNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMP QSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGV ISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSV LMILHNA
Tag Info	N-terminal 6xHis-tagged
Expression Region	1-252aa
Protein length	Full Length
MW	29.6 kDa
Alternative Name(s)	Type I DHQase
Relevance	Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site.
References	Molecular cloning and characterization of the aroD gene encoding 3-dehydroquinase from Salmonella typhi.Servos S., Chatfield S., Hone D., Levine M., Dimitriadis G., Pickard D., Dougan G., Fairweather N., Charles I.G.J. Gen. Microbiol. 137:147-152(1991)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site.
Protein Families	Type-I 3-dehydroquinase family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP326162SWW-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time