Item no. |
CSB-YP025809HU-500 |
Manufacturer |
Cusabio
|
Amount |
500ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
INCAM-100; CD106 |
Available |
|
Research Areas |
Cell Adhesion |
Uniprot ID |
P19320 |
Gene Names |
VCAM1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSW RTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYL CTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEA GKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEF LEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKL HIDEMDSVPTVRQAVKELQVYISPKNTVISVNPST KLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQH LSGNATLTLIAMRMEDSGIYVCEGVNLIGKNRKEV ELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMG CESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVS FENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEI EMSGGLVNGSSVTVSCKVPSVYPLDRLEIELLKGE TILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGK ALVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDT TVLVSPSSILEEGSSVNMTCLSQGFPAPKILWSRQ LPNGELQPLSENATLTLISTKMEDSGVYLCEGINQ AGRSRKEVELIIQVTPKDIKLTAFPSESVKEGDTV IISCTCGNVPETWIILKKKAETGDTVLKSIDGAYT IRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRE NNKDYFSPE |
Expression Region |
25-698aa |
Sequence Info |
Extracellular Domain |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
76.2 kDa |
Alternative Name(s) |
INCAM-100; CD106 |
Relevance |
Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with integrin alpha-4/beta-1 (ITGA4/ITGB1) on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/ITGA4/ITGB1 interaction may play a pathophysiologic role both in immune responses and in leukocyte igration to sites of inflammation. |
Reference |
Direct expression cloning of vascular cell adhesion molecule 1, a cytokine-induced endothelial protein that binds to lymphocytes.Osborn L., Hession C., Tizard R., Vassallo C., Luhowskyj S., Chi-Rosso G., Lobb R.Cell 59:1203-1211(1989) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with integrin alpha-4/beta-1 (ITGA4/ITGB1) on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/ITGA4/ITGB1 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation. |
Subcellular Location |
Membrane, Single-pass type I membrane protein |
Tissue Specificity |
Expressed on inflammed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflammed tissue. |
Paythway |
LipidsandInflammation inAtherogenesis |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.