Item no. |
CSB-YP023488MO-50 |
Manufacturer |
Cusabio
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Topic |
Others |
Uniprot ID |
Q03350 |
Gene Names |
Thbs2 |
Organism |
Mus musculus (Mouse) |
AA Sequence |
GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVP AYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTA QLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDT LDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVAS DTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVA KGASRESHFRGLLQNVHLVFADSVEDILSKKGCQH SQGA |
Expression Region |
19-232aa |
Sequence Info |
Partial |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
26.1 kDa |
Relevance |
Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties. |
Reference |
Characterization of mouse thrombospondin 2 sequence and expression during cell growth and development.Laherty C.D., O'Rourke K., Wolf F.W., Katz R., Seldin M.F., Dixit V.M.J. Biol. Chem. 267:3274-3281(1992) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties. |
Protein Families |
Thrombospondin family |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.