« Back
Home /
Recombinant Sheep Protransforming growth factor alpha(TGFA),partial

Recombinant Sheep Protransforming growth factor alpha(TGFA),partial

Item no.	CSB-YP023445SH-1
Manufacturer	Cusabio
Amount	1mg
Category	Oncology Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins By Organ Bladder Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	EGF-like TGF,Short name:,ETGF,TGF type 1
Available
Research Topic	Others
Uniprot ID	P98135
Gene Names	TGFA
Organism	Ovis aries (Sheep)
AA Sequence	ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGT CRFLLQEEKPACVCHSGYVGARCEHADLLAVVAAS QKKQ
Expression Region	24-97aa
Sequence Info	Extracellular Domain
Source	Yeast
Tag Info	N-terminal GST-tagged
MW	34.9 kDa
Alternative Name(s)	EGF-like TGF Short name: ETGF TGF type 1
Relevance	TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar
Reference	"Growth factor expression in skin during wool follicle development."Sutton R., Ward W.G., Raphael K.A., Cam G.R.Comp. Biochem. Physiol. 110B:697-705(1995)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
Subcellular Location	Transforming growth factor alpha: Secreted, extracellular space, SUBCELLULAR LOCATION: Protransforming growth factor alpha: Cell membrane, Single-pass type I membrane protein
Tissue Specificity	Skin.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP023445SH-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time