« Back
Home /
Recombinant Human Signal-regulatory protein gamma(SIRPG),partial

Recombinant Human Signal-regulatory protein gamma(SIRPG),partial

Item no.	CSB-YP021338HU-1
Manufacturer	Cusabio
Amount	1mg
Category	Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD172 antigen-like family member B,Signal-regulatory protein beta-2,Short name:SIRP-b2,Short name:SIRP-beta-2,CD_antigen: CD172g
Available
Research Topic	Immunology
Uniprot ID	Q9P1W8
Gene Names	SIRPG
Organism	Homo sapiens (Human)
AA Sequence	EEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGP VLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRN NMDFSIRISSITPADVGTYYCVKFRKGSPENVEFK SGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTC ESHGFSPRDITLKWFKNGNELSDFQTNVDPTGQSV AYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPL RGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQV RKFYPQSLQLTWSENGNVCQRETASTLTENKDGTY NWTSWFLVNISDQRDDVVLTCQVKHDGQLAVSKRL ALEVTVHQKDQSSDATP
Expression Region	29-360aa
Sequence Info	Extracellular Domain
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	38.8 kDa
Alternative Name(s)	CD172 antigen-like family member B Signal-regulatory protein beta-2 Short name:SIRP-b2 Short name:SIRP-beta-2 CD_antigen: CD172g
Relevance	Probable immunoglobulin-like cell surface receptor. On binding with CD47, mediates cell-cell adhesion. Engagement on T-cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell activation.
Reference	"Adhesion of human T cells to antigen-presenting cells through SIRPbeta2-CD47 interaction costimulates T-cell proliferation."Piccio L., Vermi W., Boles K.S., Fuchs A., Strader C.A., Facchetti F., Cella M., Colonna M.Blood 105:2421-2427(2005)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Probable immunoglobulin-like cell surface receptor. On binding with CD47, mediates cell-cell adhesion. Engagement on T-cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell activation.
Subcellular Location	Membrane, Single-pass type I membrane protein
Tissue Specificity	Detected in liver, and at very low levels in brain, heart, lung, pancreas, kidney, placenta and skeletal muscle. Expressed on CD4+ T-cells, CD8+ T-cells, CD56-bright natural killer (NK) cells, CD20+ cells, and all activated NK cells. Mainly present in the paracortical T-cell area of lymph nodes, with only sparse positive cells in the mantle and in the germinal center of B-cell follicles. In the thymus, primarily expressed in the medulla on mature T-lymphocytes that have undergone thymic selection.
Paythway	Osteoclastdifferentiation
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time