Item no. |
CSB-YP021000HU-10 |
Manufacturer |
Cusabio
|
Amount |
10ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
CDw108,JMH blood group antigen,John-Milton-Hargen human blood group Ag,Semaphorin-K1,Short name:,Sema K1,Semaphorin-L,Short name:,Sema L,CD_antigen: CD108 |
Available |
|
Research Topic |
Cardiovascular |
Uniprot ID |
O75326 |
Gene Names |
SEMA7A |
Organism |
Homo sapiens (Human) |
AA Sequence |
QGHLRSGPRIFAVWKGHVGQDRVDFGQTEPHTVLF HEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIG STKGSCLDKRDCENYITLLERRSEGLLACGTNARH PSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEG DEVYSTIRKQEYNGKIPRFRRIRGESELYTSDTVM QNPQFIKATIVHQDQAYDDKIYYFFREDNPDKNPE APLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAML VCSDAATNKNFNRLQDVFLLPDPSGQWRDTRVYGV FSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHSSLP NPRPGKCLPDQQPIPTETFQVADRHPEVAQRVEPM GPLKTPLFHSKYHYQKVAVHRMQASHGETFHVLYL TTDRGTIHKVVEPGEQEHSFAFNIMEIQPFRRAAA IQTMSLDAERRKLYVSSQWEVSQVPLDLCEVYGGG CHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINP AEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPME SRHATYSWRHKENVEQSCEPGHQSPNCILFIENLT AQQYGHYFCEAQEGSYFREAQHWQLLPEDGIMAEH LLGHACALA |
Expression Region |
45-648aa |
Sequence Info |
Full Length of Mature Protein |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
70.4 kDa |
Alternative Name(s) |
CDw108 JMH blood group antigen John-Milton-Hargen human blood group Ag Semaphorin-K1 Short name: Sema K1 Semaphorin-L Short name: Sema L CD_antigen: CD108 |
Relevance |
Plays an important role in integrin-mediated signaling and functions both in regulating cell migration and immune responses. Promotes formation of focal adhesion complexes, activation of the protein kinase PTK2/FAK1 and subsequent phosphorylation of MAPK1 and MAPK3. Promotes production of proinflammatory cytokines by monocytes and macrophages. Plays an important role in modulating inflammation and T-cell-mediated immune responses. Promotes axon growth in the embryonic olfactory bulb. Promotes attachment, spreading and dendrite outgrowth in melanocytes. |
Reference |
"Semaphorin 7A promotes axon outgrowth through integrins and MAPKs."Pasterkamp R.J., Peschon J.J., Spriggs M.K., Kolodkin A.L.Nature 424:398-405(2003) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Plays an important role in integrin-mediated signaling and functions both in regulating cell migration and immune responses. Promotes formation of focal adhesion complexes, activation of the protein kinase PTK2/FAK1 and subsequent phosphorylation of MAPK1 and MAPK3. Promotes production of proinflammatory cytokines by monocytes and macrophages. Plays an important role in modulating inflammation and T-cell-mediated immune responses. Promotes axon growth in the embryonic olfactory bulb. Promotes attachment, spreading and dendrite outgrowth in melanocytes. |
Subcellular Location |
Cell membrane, Lipid-anchor, GPI-anchor, Extracellular side |
Protein Families |
Semaphorin family |
Tissue Specificity |
Detected in skin keratinocytes and on endothelial cells from skin blood vessels (at protein level). Expressed in fibroblasts, keratinocytes, melanocytes, placenta, testis, ovary, spleen, brain, spinal chord, lung, heart, adrenal gland, lymph nodes, thymus, intestine and kidney. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.