« Back
Home /
Recombinant Human Oxytocin-neurophysin 1(OXT)

Recombinant Human Oxytocin-neurophysin 1(OXT)

Item no.	CSB-YP017315HU(A4)-50
Manufacturer	Cusabio
Amount	50ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Skin Cancer Uterine, Ovarian & Cervical Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Others
Uniprot ID	P01178
Gene Names	OXT
Organism	Homo sapiens (Human)
AA Sequence	CYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFG PNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQ KACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQ
Expression Region	20-125aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	Tag-Free
MW	10.9 kDa
Alternative Name(s)	Ocytocin
Relevance	Neurophysin 1 specifically binds oxytocin. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland.
Reference	"The neurohypophyseal hormones vasopressin and oxytocin. Precursor structure, synthesis and regulation." Rehbein M., Hillers M., Mohr E., Ivell R., Morley S., Schmale H., Richter D. Biol. Chem. Hoppe-Seyler 367:695-704(1986)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Neurophysin 1 specifically binds oxytocin.; FUNCTION
Subcellular Location	Secreted
Protein Families	Vasopressin/oxytocin family
Tag Information	Tag-Free

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time