Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
Yeast |
Item no. |
CSB-YP016078HU-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Alias |
Divergent of neuregulin-1,Short name:,DON-1,Neural- and thymus-derived activator for ERBB kinases,Short name:,NTAK |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Research Topic |
Neuroscience |
Uniprot ID |
O14511 |
Gene Names |
NRG2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSS NSTREPPASGRVALVKVLDKWPLRSGGLQREQVIS VGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDT NGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGE KQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIK YGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDT VRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNG GVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYM PDPKQKAEELYQKR |
Expression Region |
112-405aa |
Sequence Info |
Extracellular Domain |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
34.8 kDa |
Alternative Name(s) |
Divergent of neuregulin-1 Short name: DON-1 Neural- and thymus-derived activator for ERBB kinases Short name: NTAK |
Relevance |
Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor. |
Reference |
"A novel brain-derived member of the epidermal growth factor family that interacts with ErbB3 and ErbB4."Higashiyama S., Horikawa M., Yamada K., Ichino N., Nakano N., Nakagawa T., Miyagawa J., Matsushita N., Nagatsu T., Taniguchi N., Ishiguro H.J. Biochem. 122:675-680(1997) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor. |
Subcellular Location |
Pro-neuregulin-2, membrane-bound isoform: Cell membrane, Single-pass type I membrane protein |
Protein Families |
Neuregulin family |
Tissue Specificity |
Restricted to the cerebellum in the adult. |
Paythway |
ErbBsignalingpathway |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.