« Back
Home /
Recombinant Rat Monoglyceride lipase(Mgll)

Recombinant Rat Monoglyceride lipase(Mgll)

Item no.	CSB-YP013787RA-1
Manufacturer	Cusabio
Amount	1mg
Category	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	MGL,Alternative name(s):,Monoacylglycerol lipase,Short name:,MAGL
Available
Research areas	Cardiovascular
Target / Protein	Mgll
Biologically active	Not Test
Expression system	Yeast
Species of origin	Rattus norvegicus (Rat)
Uniprot ID	Q8R431
AA Sequence	MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYW KPSGTPKALIFVSHGAGEHCGRYDELAQMLKRLDM LVFAHDHVGHGQSEGERMVVSDFQVFVRDLLQHVN TVQKDYPEVPVFLLGHSMGGAISILAAAERPTHFS GMILISPLILANPESASTLKVLAAKLLNFVLPNIS LGRIDSSVLSRNKSEVDLYNSDPLICHAGVKVCFG IQLLNAVSRVERAMPRLTLPFLLLQGSADRLCDSK GAYLLMESSPSQDKTLKMYEGAYHVLHKELPEVTN SVLHEINTWVSHRIAVAGARCLP
Tag Info	N-terminal 6xHis-tagged
Expression Region	1-303aa
Protein length	Full Length
MW	35.5 kDa
Alternative Name(s)	MGL Alternative name(s): Monoacylglycerol lipase Short name: MAGL
Relevance	Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth.
References	"Brain monoglyceride lipase participating in endocannabinoid inactivation."Dinh T.P., Carpenter D., Leslie F.M., Freund T.F., Katona I., Sensi S.L., Kathuria S., Piomelli D.Proc. Natl. Acad. Sci. U.S.A. 99:10819-10824(2002).
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth.
Subcellular Location	Cytoplasm, cytosol, Membrane, Peripheral membrane protein
Protein Families	AB hydrolase superfamily, Monoacylglycerol lipase family
Tissue Specificity	Ubiquitous. Highly expressed in adipose tissue, adrenal gland, ovary, heart, spleen, lung, skeletal muscle, kidney and testis. Highly expressed throughout the brain.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time