Item no. |
CSB-YP013529MO-200 |
Manufacturer |
Cusabio
|
Amount |
200ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Conjugate/Tag |
Myc |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research areas |
Cardiovascular |
Target / Protein |
Mb |
Biologically active |
Not Test |
Expression system |
Yeast |
Species of origin |
Mus musculus (Mouse) |
Uniprot ID |
P04247 |
AA Sequence |
GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKT HPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLT ALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLE FISEIIIEVLKKRHSGDFGADAQGAMSKALELFRN DIAAKYKELGFQG |
Tag Info |
N-terminal 6xHis-tagged and C-terminal Myc-tagged |
Expression Region |
2-154aa |
Protein length |
Full Length of Mature Protein |
MW |
18.9 kDa |
Relevance |
Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. |
References |
"The mouse myoglobin gene. Characterisation and sequence comparison with other mammalian myoglobin genes." Blanchetot A., Price M., Jeffreys A.J. Eur. J. Biochem. 159:469-474(1986) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. |
Protein Families |
Globin family |
Tag Information |
N-terminal 6xHis-tagged and C-terminal Myc-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.