Item no. |
CSB-YP013481MO-1 |
Manufacturer |
Cusabio
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Neurofibrillary tangle protein,Paired helical filament-tau,Short name:,PHF-tau |
Available |
|
Research areas |
Neuroscience |
Target / Protein |
Mapt |
Biologically active |
Not Test |
Expression system |
Yeast |
Species of origin |
Mus musculus (Mouse) |
Uniprot ID |
P10637 |
AA Sequence |
ADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKESP PQPPADDGAEEPGSETSDAKSTPTAEDVTAPLVDE RAPDKQAAAQPHTEIPEGITAEEAGIGDTPNQEDQ AAGHVTQGRREGQAPDLGTSDWTRQQVSSMSGAPL LPQGLREATCQPSGTRPEDIEKSHPASELLRRGPP QKEGWGQDRLGSEEEVDEDLTVDESSQDSPPSQAS LTPGRAAPQAGSGSVCGETASVPGLPTEGSVPLPA DFFSKVSAETQASQPEGPGTGPMEEGHEAAPEFTF HVEIKASTPKEQDLEGATVVGVPGEEQKAQTQGPS VGKGTKEASLQEPPGKQPAAGLPGRPVSRVPQLKA RVASKDRTGNDEKKAKTSTPSCAKAPSHRPCLSPT RPTLGSSDPLIKPSSPAVSPEPATSPKHVSSVTPR NGSPGTKQMKLKGADGKTGAKIATPRGAASPAQKG TSNATRIPAKTTPSPKTPPGSGEPPKSGERSGYSS PGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPK SPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQ PGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGG SVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEV KSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETH KLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLS NVSSTGSIDMVDSPQLATLADEVSASLAKQGL |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
2-733aa |
Protein length |
Full Length of Mature Protein |
MW |
78.1 kDa |
Alternative Name(s) |
Neurofibrillary tangle protein Paired helical filament-tau Short name: PHF-tau |
Relevance |
Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization. |
References |
"Expression of three- and four-repeat tau isoforms in mouse liver."Kenner L., el-Shabrawi Y., Hutter H., Forstner M., Zatloukal K., Hoefler G., Preisegger K.-H., Kurzbauer R., Denk H.Hepatology 20:1086-1089(1994) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization. |
Involvement in disease |
May be involved in the pathogenesis of cytoplasmic inclusions (as Mallory bodies) in livers of mice chronically intoxicated with Griseofulvin or DDC (3, 5-diethoxycarbonyl-2, 4-dihydrocollidine), a model for human alcoholic hepatitis. Alteration of Tau (abnormal phosphorylation and cross-linking) could contribute to Mallory bodies formation and disturbance of microtubule function in alcoholic liver disease. |
Subcellular Location |
Cytoplasm, cytosol, Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cytoplasm, cytoskeleton, Cell projection, axon |
Tissue Specificity |
Expressed in neurons and at a lower level in the liver and kidney. Isoform PNS-tau is expressed in the peripheral nervous system while the others are expressed in the central nervous system. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.