« Back
Home /
Recombinant Dog Interleukin-4(IL4)

Recombinant Dog Interleukin-4(IL4)

Item no.	CSB-YP011659DO-200
Manufacturer	Cusabio
Amount	200ug
Quantity options	1mg 10ug 100ug 200ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	Yeast
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Alternative Name(s)	B-cell stimulatory factor 1 ; BSF-1Lymphocyte stimulatory factor 1
AA Sequence	HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTA PKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYR NLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKY YRH
Research Topic	Others
Uniprot ID	O77762
Gene Names	IL4
Tag Info	N-terminal 6xHis-tagged
Expression Region	25-132aa
MW of Fusion Proten	14, 8
Sequence Info	Full Length
Relevance	Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes .
Reference	Molecular cloning and sequencing of the cDNA for dog interleukin-4.van der Kaaij S.Y., Pinelli E., Broeren C.P.M., Schetters T.P.M., Haghparast A., Ruitenberg E.J., Rutten V.P.M.G.Immunogenetics 49:142-143(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Canis lupus familiaris (Dog) (Canis familiaris)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time