« Back
Home /
Recombinant Mouse Insulin-like growth factor-binding protein 1(Igfbp1)

Recombinant Mouse Insulin-like growth factor-binding protein 1(Igfbp1)

Item no.	CSB-YP011095MO-1
Manufacturer	Cusabio
Amount	1mg
Category	Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Others
Uniprot ID	P47876
Gene Names	Igfbp1
Organism	Mus musculus (Mouse)
AA Sequence	APQPWHCAPCTAERLGLCPPVPASCPEISRPAGCG CCPTCALPMGAACGVATARCAQGLSCRALPGEPRP LHALTRGQGACVPEPAAPATSTLFSSQHEEAKAAV VSADELSESPEMTEEQLLDSFHLMAPSREDQPILW NAISTYSSMRAREIADLKKWKEPCQRELYKVLERL AAAQQKAGDEIYKFYLPNCNKNGFYHSKQCETSLD GEAGLCWCVYPWSGKKIPGSLETRGDPNCHQYFNV HN
Expression Region	26-272aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	28.9 kDa
Relevance	IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration .
Reference	cDNA cloning and mRNA expression of the six mouse insulin-like growth factor binding proteins.Schuller A.G.P., Groffen C., van Neck J.W., Zwarthoff E.C., Drop S.L.S.Mol. Cell. Endocrinol. 104:57-66(1994)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration (By similarity).
Subcellular Location	Secreted
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP011095MO-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time