Item no. |
CSB-YP010947HU(F1)-50 |
Manufacturer |
Cusabio
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
69KDA islet cell autoantigen,Short name:,ICA69,Islet cell autoantigen p69,Short name:,ICAp69,Short name:,p69 |
Available |
|
Research Topic |
Neuroscience |
Uniprot ID |
Q05084 |
Gene Names |
ICA1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSGHKCYPWDLQDRYAQDKSVVNKMQQKYWETKQA FIKATGKKEDEHVVASDADLDAKLELFHSIQRTCL DLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDK TRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEV ETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDV SQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMD VCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTS HTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEKE EKKKINQQESTDAAVQEPSQLISLEEENQRKESSS FKTEDGKSILSALDKGSTHTACSGPIDELLDMKSE EGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLE EGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQT GSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWF SLFADLDPLSNPDAVGKTDKEHELLNA |
Expression Region |
1-482aa |
Sequence Info |
Full Length of Isoform 3 |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
56.6 kDa |
Alternative Name(s) |
69KDA islet cell autoantigen Short name: ICA69 Islet cell autoantigen p69 Short name: ICAp69 Short name: p69 |
Relevance |
May play a role in neurotransmitter secretion. |
Reference |
"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004). |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
May play a role in neurotransmitter secretion. |
Subcellular Location |
Cytoplasm, cytosol, Golgi apparatus membrane, Peripheral membrane protein, Cytoplasmic vesicle, secretory vesicle membrane, Peripheral membrane protein, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Peripheral membrane protein |
Tissue Specificity |
Expressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.