Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Amount |
10ug |
Host |
Yeast |
Item no. |
CSB-YP007409HU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Alternative Name(s) |
Elongation factor Tu ; EF-TuEukaryotic elongation factor 1 A-1 ; e; EF1A-1Leukocyte receptor cluster member 7 |
AA Sequence |
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGID KRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERG ITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITG TSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA YTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVS TYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPW FKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKP LRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF APVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNV SVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP GQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGK KLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSA QKAQKAK |
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
P68104 |
Gene Names |
EEF1A1 |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
1-462aa |
MW of Fusion Proten |
52, 1 |
Sequence Info |
Full Length |
Relevance |
This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. With PARP1 and TXK, forms a complex that acts as a T helper 1 (Th1) cell-specific transcription factor and binds the promoter of IFN-gamma to directly regulate its transcription, and is thus involved importantly in Th1 cytokine production. |
Reference |
The primary structure of the alpha subunit of human elongation factor 1. Structural aspects of guanine-nucleotide-binding sites.Brands J.H.G.M., Maassen J.A., van Hemert F.J., Amons R., Moeller W.Eur. J. Biochem. 155:167-171(1986) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Species |
Homo sapiens (Human) |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.