« Back
Home /
Recombinant Human Dynamin-1(DNM1),partial

Recombinant Human Dynamin-1(DNM1),partial

Item no.	CSB-YP007062HU-50
Manufacturer	Cusabio
Amount	50ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Neuroscience
Uniprot ID	Q05193
Gene Names	DNM1
Organism	Homo sapiens (Human)
AA Sequence	GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAV VGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVL QLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETD RVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMT KVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSP ANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMD EGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGK
Expression Region	2-245aa
Sequence Info	Partial
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	28.7 kDa
Relevance	Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Involved in receptor-mediated endocytosis.
Reference	Mutations in human dynamin block an intermediate stage in coated vesicle formation.van der Bliek A.M., Redelmeier T.E., Tisdale E.J., Meyerowitz E.M., Schmid S.L.J. Cell Biol. 122:553-563(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Involved in receptor-mediated endocytosis.
Involvement in disease	Epileptic encephalopathy, early infantile, 31 (EIEE31)
Subcellular Location	Cytoplasm, Cytoplasm, cytoskeleton
Protein Families	TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family
Paythway	OxidativePhosphorylation
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP007062HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time