« Back
Home /
Recombinant Human D-amino-acid oxidase(DAO)

Recombinant Human D-amino-acid oxidase(DAO)

Item no.	CSB-YP006494HU-1
Manufacturer	Cusabio
Amount	1mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Short name:,DAAO,Short name:,DAMOX,Short name:,DAO
Available
Research Topic	Metabolism
Uniprot ID	P14920
Gene Names	DAO
Organism	Homo sapiens (Human)
AA Sequence	MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVY ADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQ TFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDP SWKDTVLGFRKLTPRELDMFPDYGYGWFHTSLILE GKNYLQWLTERLTERGVKFFQRKVESFEEVAREGA DVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWM KHFILTHDPERGIYNSPYIIPGTQTVTLGGIFQLG NWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERT GFRPVRPQIRLEREQLRTGPSNTEVIHNYGHGGYG LTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
Expression Region	1-347aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	41.5 kDa
Alternative Name(s)	Short name: DAAO Short name: DAMOX Short name: DAO
Relevance	Regulates the level of the neuromodulator D-serine in the brain. Has high activity towards D-DOPA and contributes to dopamine synthesis. Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids.
Reference	"Complete sequencing and characterization of 21, 243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Regulates the level of the neuromodulator D-serine in the brain. Has high activity towards D-DOPA and contributes to dopamine synthesis. Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids.
Involvement in disease	Schizophrenia (SCZD)
Subcellular Location	Peroxisome
Protein Families	DAMOX/DASOX family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP006494HU-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time