« Back
Home /
Recombinant Chicken Collagen alpha-1(XII) chain(COL12A1),partial

Recombinant Chicken Collagen alpha-1(XII) chain(COL12A1),partial

Item no.	CSB-YP005719CH-1
Manufacturer	Cusabio
Amount	1mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fibrochimerin
Available
Research Topic	Others
Uniprot ID	P13944
Gene Names	COL12A1
Organism	Gallus gallus (Chicken)
AA Sequence	DLVFLVDGSWSVGRNNFRYILDFMVALVSAFDIGE EKTRVGVVQYSSDTRTEFNLNQYFRRSDLLDAIKR IPYKGGNTMTGEAIDYLVKNTFTESAGARKGFPKV AIVITDGKAQDEVEIPARELRNIGVEVFSLGIKAA DAKELKLIASQPSLKHVFNVANFDGIVDIQNEI
Expression Region	139-311aa
Sequence Info	Partial
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	21.3 kDa
Alternative Name(s)	Fibrochimerin
Relevance	Type XII collagen interacts with type I collagen-containing fibrils, the COL1 domain could be associated with the surface of the fibrils, and the COL2 and NC3 domains may be localized in the perifibrillar matrix.
Reference	The complete primary structure of type XII collagen shows a chimeric molecule with reiterated fibronectin type III motifs, von Willebrand factor A motifs, a domain homologous to a noncollagenous region of type IX collagen, and short collagenous domains with an Arg-Gly-Asp site.Yamagata M., Yamada K.M., Yamada S.S., Shinomura T., Tanaka H., Nishida Y., Obara M., Kimata K.J. Cell Biol. 115:209-221(1991)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Type XII collagen interacts with type I collagen-containing fibrils, the COL1 domain could be associated with the surface of the fibrils, and the COL2 and NC3 domains may be localized in the perifibrillar matrix.
Subcellular Location	Secreted, extracellular space, extracellular matrix
Protein Families	Fibril-associated collagens with interrupted helices (FACIT) family
Tissue Specificity	Type XII collagen is present in tendons, ligaments, perichondrium, and periosteum, all dense connective tissues containing type I collagen.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP005719CH-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time