« Back
Home /
Recombinant Human Connector enhancer of kinase suppressor of ras 2(CNKSR2),partial

Recombinant Human Connector enhancer of kinase suppressor of ras 2(CNKSR2),partial

Item no.	CSB-YP005653HU-10
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CNK homolog protein 2 ;CNK2
Available
Research Topic	Signal Transduction
Uniprot ID	Q8WXI2
Gene Names	CNKSR2
Organism	Homo sapiens (Human)
AA Sequence	AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYW SESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCA SPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSA VSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPL EDSVFSDSAAI
Expression Region	650-800aa
Sequence Info	Partial
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	19.1 kDa
Alternative Name(s)	CNK homolog protein 2 ; CNK2
Relevance	May function as an adapter protein or regulator of Ras signaling pathways.
Reference	Human homologue of Drosophila CNK interacts with Ras effector proteins Raf and Rlf.Lanigan T.M., Liu A., Huang Y.Z., Mei L., Margolis B., Guan K.-L.FASEB J. 17:2048-2060(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May function as an adapter protein or regulator of Ras signaling pathways.
Subcellular Location	Cytoplasm, Membrane, Peripheral membrane protein
Protein Families	CNKSR family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time