« Back
Home /
Recombinant Human Cartilage intermediate layer protein 1(CILP),partial

Recombinant Human Cartilage intermediate layer protein 1(CILP),partial

Item no.	CSB-YP005437HU-1
Manufacturer	Cusabio
Amount	1mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Immunology
Uniprot ID	O75339
Gene Names	CILP
Organism	Homo sapiens (Human)
AA Sequence	EDRTFLVGNLEIRERRLFNLDVPESRRCFVKVRAY RSERFLPSEQIQGVVISVINLEPRTGFLSNPRAWG RFDSVITGPNGACVPAFCDDQSPDAYSAYVLASLA GEELQAVESSPKFNPNAIGVPQPYLNKLNYRRTDH EDPRVKKTAFQISMAKPRPNSAEESNGPIYAFENL RACEEAPPSAAHFRFYQIEGDRYDYNTVPFNEDDP MSWTEDYLAWWPKPMEFRACYIKVKIVGPLEVNVR SRNMGGTHRQTVGKLYGIRDVRSTRDRDQPNVSAA CLEFKCSGMLYDQDRVDRTLVKVIPQGSCRRASVN PMLHEYLVNHLPLAVNNDTSEYTMLAPLDPLGHNY GIYTVTDQDPRTAKEIALGRCFDGTSDGSSRIMKS NVGVALTFNCVERQVGRQSAFQYLQSTPAQSPAAG TVQGRVPSRRQQRASRGGQRQGGVVASLRFPRVAQ QPLIN
Expression Region	725-1184aa
Sequence Info	Partial
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	53.7 kDa
Alternative Name(s)	Cartilage intermediate-layer protein
Relevance	Probably plays a role in cartilage scaffolding. May act by antagonizing TGF-beta1 (TGFB1) and IGF1 functions. Has the ability to suppress IGF1-induced proliferation and sulfated proteoglycan synthesis, and inhibits ligand-induced IGF1R autophosphorylation. May inhibit TGFB1-mediated induction of cartilage matrix genes via its interaction with TGFB1. Overexpression may lead to impair chondrocyte growth and matrix repair and indirectly promote inorganic pyrophosphate (PPi) supersaturation in aging and osteoarthritis cartilage.
Reference	"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M. Genome Res. 13:2265-2270(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Probably plays a role in cartilage scaffolding. May act by antagonizing TGF-beta1 (TGFB1) and IGF1 functions. Has the ability to suppress IGF1-induced proliferation and sulfated proteoglycan synthesis, and inhibits ligand-induced IGF1R autophosphorylation. May inhibit TGFB1-mediated induction of cartilage matrix genes via its interaction with TGFB1. Overexpression may lead to impair chondrocyte growth and matrix repair and indirectly promote inorganic pyrophosphate (PPi) supersaturation in aging and osteoarthritis cartilage.
Involvement in disease	Intervertebral disc disease (IDD)
Subcellular Location	Secreted, extracellular space, extracellular matrix
Tissue Specificity	Specifically expressed in cartilage. Localizes in the intermediates layer of articular cartilage but neither in the superficial nor in the deepest regions. Specifically and highly expressed in intervertebral disk tissue. Expression increases with aging in hip articular cartilage. Overexpressed in articular hyaline cartilage from patients with calcium pyrophosphate dihydrate crystal deposition disease (CPPD). Expression in intervertebral disk tissue from individuals with lumbar disk disease increases as disk degeneration progresses.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time