Item no. |
CSB-YP005386MO-10 |
Manufacturer |
Cusabio
|
Amount |
10ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Topic |
Others |
Uniprot ID |
P04756 |
Gene Names |
Chrna1 |
Organism |
Mus musculus (Mouse) |
AA Sequence |
SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGL QLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPD DYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKF TKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQ NCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGE WVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL |
Expression Region |
21-230aa |
Sequence Info |
Extracellular Domain |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
26.5 kDa |
Relevance |
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma mbrane. |
Reference |
Nucleotide sequence of the mouse muscle nicotinic acetylcholine receptor alpha subunit.Isenberg K.E., Mudd J., Shah V., Merlie J.P.Nucleic Acids Res. 14:5111-5111(1986) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. |
Subcellular Location |
Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein |
Protein Families |
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.