« Back
Home /
Recombinant Human T-complex protein 1 subunit beta(CCT2)

Recombinant Human T-complex protein 1 subunit beta(CCT2)

Item no.	CSB-YP004856HU-1
Manufacturer	Cusabio
Amount	1mg
Category	Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CCT-beta
Available
Research Topic	Signal Transduction
Uniprot ID	P78371
Gene Names	CCT2
Organism	Homo sapiens (Human)
AA Sequence	ASLSLAPVNIFKAGADEERAETARLTSFIGAIAIG DLVKSTLGPKGMDKILLSSGRDASLMVTNDGATIL KNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLA AELLREAESLIAKKIHPQTIIAGWREATKAAREAL LSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHK DHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLAD SYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDT DKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVER ILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHAD FAGVERLALVTGGEIASTFDHPELVKLGSCKLIEE VMIGEDKLIHFSGVALGEACTIVLRGATQQILDEA ERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAV TQLANRTPGKEAVAMESYAKALRMLPTIIADNAGY DSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAIL GITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPR KRVPDHHPC
Expression Region	2-535aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	59.4 kDa
Alternative Name(s)	CCT-beta
Relevance	Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.
Reference	"Maturation of human cyclin E requires the function of eukaryotic chaperonin CCT."Won K.-A., Schumacher R.J., Farr G.W., Horwich A.L., Reed S.I.Mol. Cell. Biol. 18:7584-7589(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.
Subcellular Location	Cytoplasm
Protein Families	TCP-1 chaperonin family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time