« Back
Home /
Recombinant Mouse C1q-related factor(C1ql1)

Recombinant Mouse C1q-related factor(C1ql1)

Item no.	CSB-YP003642MO-1
Manufacturer	Cusabio
Amount	1mg
Category	Neuroscience Metabolism Glucose Homeostasis Neural Signaling Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	C1q and tumor necrosis factor-related protein 14,Short name:,C1q/TNF-related protein 14,Short name:,CTRP14,Complement component 1 Q subcomponent-like 1
Available
Research Topic	Others
Uniprot ID	O88992
Gene Names	C1ql1
Organism	Mus musculus (Mouse)
AA Sequence	GPDGHYEMLGTCRMVCDPYPARGPGAGARSDGGDA LSEQSGAPPPSTLVQGPQGKPGRTGKPGPPGPPGD RGPPGPVGPPGEKGEPGKPGPPGLPGSGGSGAIST ATYTTVPRVAFYAGLKNPHEGYEVLKFDDVVTNLG NNYDAASGKFTCNIPGTYFFTYHVLMRGGDGTSMW ADLCKNGQVRASAIAQDADQNYDYASNSVILHLDA GDEVFIKLDGGKAHGGNSNKYSTFSGFIIYSD
Expression Region	17-258aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	26.9 kDa
Alternative Name(s)	C1q and tumor necrosis factor-related protein 14 Short name: C1q/TNF-related protein 14 Short name: CTRP14 Complement component 1 Q subcomponent-like 1
Relevance	May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses
Reference	"Lineage-specific biology revealed by a finished genome assembly of the mouse."Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time