« Back
Home /
Recombinant Human Probetacellulin(BTC)

Recombinant Human Probetacellulin(BTC)

Item no.	CSB-YP002853HU-10
Manufacturer	Cusabio
Amount	10ug
Category	Oncology Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins By Organ Skin Cancer Bladder Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Signal Transduction
Uniprot ID	P35070
Gene Names	BTC
Organism	Homo sapiens (Human)
AA Sequence	DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHF SRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIG ARCERVDLFYLRGDRGQILVICLIAVMVVFIILVI GVCTCCHPLRKRRKRKKKEEEMETLGKDITPINED IEETNIA
Expression Region	32-178aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	18.6 kDa
Relevance	Growth factor that binds to EGFR, ERBB4 and other EGF receptor family mbers. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.
Reference	Cloning and expression of cDNA encoding human betacellulin, a new member of the EGF family.Sasada R., Ono Y., Taniyama Y., Shing Y., Folkman J., Igarashi K.Biochem. Biophys. Res. Commun. 190:1173-1179(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.
Subcellular Location	Betacellulin: Secreted, extracellular space, SUBCELLULAR LOCATION: Probetacellulin: Cell membrane, Single-pass type I membrane protein
Tissue Specificity	Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine.
Paythway	ErbBsignalingpathway
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time