« Back
Home /
Recombinant Escherichia coli NAD(P)H-flavin reductase(fre)

Recombinant Escherichia coli NAD(P)H-flavin reductase(fre)

Item no.	CSB-RP185374Ba-50
Manufacturer	Cusabio
Amount	50ug
Quantity options	1mg 10ug 100ug 200ug 20ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Aquacobalamin reductaseFMN reductaseFerrisiderophore reductase CNAD(P)H:flavin oxidoreductaseRiboflavin reductase [NAD(P)H]
Available
Research Topic	Others
Uniprot ID	P0AEN1
Gene Names	fre
Organism	Escherichia coli (strain K12)
AA Sequence	TTLSCKVTSVEAITDTVYRVRIVPDAAFSFRAGQY LMVVMDERDKRPFSMASTPDEKGFIELHIGASEIN LYAKAVMDRILKDHQIVVDIPHGEAWLRDDEERPM ILIAGGTGFSYARSILLTALARNPNRDITIYWGGR EEQHLYDLCELEALSLKHPGLQVVPVVEQPEAGWR GRTGTVLTAVLQDHGTLAEHDIYIAGRFEMAKIAR DLFCSERNAREDRLFGDAFAFI
Expression Region	2-233aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	30.1 kDa
Alternative Name(s)	Aquacobalamin reductaseFMN reductaseFerrisiderophore reductase CNAD(P)H:flavin oxidoreductaseRiboflavin reductase [NAD(P)H]
Relevance	Catalyzes the reduction of soluble flavins by reduced pyridine nucleotides. Ses to reduce the complexed Fe3+ iron of siderophores to Fe2+, thus releasing it from the chelator.
Reference	Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the reduction of soluble flavins by reduced pyridine nucleotides. Seems to reduce the complexed Fe(3+) iron of siderophores to Fe(2+), thus releasing it from the chelator.
Protein Families	Fre/LuxG FAD/NAD(P) flavoprotein oxidoreductase family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time