Item no. |
CSB-RP160274h-200 |
Manufacturer |
Cusabio
|
Amount |
200ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Host |
E.coli |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Myelin transcription factor I ;MyTIPLPB1;Proteolipid protein-binding protein |
Available |
|
Research Topic |
Developmental Biology |
Uniprot ID |
Q01538 |
Gene Names |
MYT1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
GLGHISGKYASHRSASGCPLAARRQKEGSLNGSSF SWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSG CPRATFAGKKGKLSGDEVLSPKFKTSDVLENDEEI KQLNQEIRDLNESNSEMEAAMVQLQSQISSMEKNL KNIEEENKLIEEQNEALFLELSGLSQALIQSLANI RLPHMEPICEQNFDAYVSTLTDMYSNQ |
Expression Region |
900-1101aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
26.1 kDa |
Alternative Name(s) |
Myelin transcription factor I ; MyTIPLPB1; Proteolipid protein-binding protein |
Relevance |
Binds to the promoter regions of proteolipid proteins of the central nervous syst. May play a role in the development of neurons and oligodendrogalia in the CNS. May regulate a critical transition point in oligodendrocyte lineage development by modulating oligodendrocyte progenitor proliferation relative to terminal differentiation and up-regulation of myelin gene transcription. |
Reference |
Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 5:355-364(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Binds to the promoter region of genes encoding proteolipid proteins of the central nervous system. May play a role in the development of neurons and oligodendroglia in the CNS. May regulate a critical transition point in oligodendrocyte lineage development by modulating oligodendrocyte progenitor proliferation relative to terminal differentiation and up-regulation of myelin gene transcription. |
Subcellular Location |
Nucleus |
Protein Families |
MYT1 family |
Tissue Specificity |
Mostly in developing nervous system. Expressed in neural progenitors and oligodendrocyte lineage cells. More highly expressed in oligodendrocyte progenitors than in differentiated oligodendrocytes. |
Paythway |
MAPKErkPathway |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.