« Back
Home /
Recombinant Human Myelin transcription factor 1(MYT1),partial

Recombinant Human Myelin transcription factor 1(MYT1),partial

Item no.	CSB-RP160274h-200
Manufacturer	Cusabio
Amount	200ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Myelin transcription factor I ;MyTIPLPB1;Proteolipid protein-binding protein
Available
Research Topic	Developmental Biology
Uniprot ID	Q01538
Gene Names	MYT1
Organism	Homo sapiens (Human)
AA Sequence	GLGHISGKYASHRSASGCPLAARRQKEGSLNGSSF SWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSG CPRATFAGKKGKLSGDEVLSPKFKTSDVLENDEEI KQLNQEIRDLNESNSEMEAAMVQLQSQISSMEKNL KNIEEENKLIEEQNEALFLELSGLSQALIQSLANI RLPHMEPICEQNFDAYVSTLTDMYSNQ
Expression Region	900-1101aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	26.1 kDa
Alternative Name(s)	Myelin transcription factor I ; MyTIPLPB1; Proteolipid protein-binding protein
Relevance	Binds to the promoter regions of proteolipid proteins of the central nervous syst. May play a role in the development of neurons and oligodendrogalia in the CNS. May regulate a critical transition point in oligodendrocyte lineage development by modulating oligodendrocyte progenitor proliferation relative to terminal differentiation and up-regulation of myelin gene transcription.
Reference	Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 5:355-364(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to the promoter region of genes encoding proteolipid proteins of the central nervous system. May play a role in the development of neurons and oligodendroglia in the CNS. May regulate a critical transition point in oligodendrocyte lineage development by modulating oligodendrocyte progenitor proliferation relative to terminal differentiation and up-regulation of myelin gene transcription.
Subcellular Location	Nucleus
Protein Families	MYT1 family
Tissue Specificity	Mostly in developing nervous system. Expressed in neural progenitors and oligodendrocyte lineage cells. More highly expressed in oligodendrocyte progenitors than in differentiated oligodendrocytes.
Paythway	MAPKErkPathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time