« Back
Home /
Recombinant Human CCAAT/enhancer-binding protein gamma(CEBPG),partial

Recombinant Human CCAAT/enhancer-binding protein gamma(CEBPG),partial

Manufacturer	Cusabio
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Bladder Cancer Breast Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	E.coli
Item no.	CSB-RP135574h-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Purity	Greater than 90% as determined by SDS-PAGE.
Research Topic	Transcription
Uniprot ID	P53567
Gene Names	CEBPG
Organism	Homo sapiens (Human)
AA Sequence	MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLV PAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRE RNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLE AKIKLLTKELSVLKDLFLEHAHNLADNVQSISTEN TTADGDNA
Expression Region	1-148aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	20.2 kDa
Relevance	Transcription factor that binds to the enhancer elent PRE-I (positive regulatory elent-I) of the IL-4 gene. Might change the DNA-binding specificity of other transcription factors and recruit th to unusual DNA sites.
Reference	Cloning of the cDNA encoding human C/EBP gamma, a protein binding to the PRE-I enhancer element of the human interleukin-4 promoter.Davydov I.V., Bohmann D., Krammer P.H., Li-Weber M.Gene 161:271-275(1995)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene
Subcellular Location	Nucleus
Protein Families	BZIP family, C/EBP subfamily
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time