« Back
Home /
Recombinant Human Midkine(MDK)

Recombinant Human Midkine(MDK)

Item no.	CSB-RP105744h-1
Manufacturer	Cusabio
Amount	1mg
Category	Oncology Neuroscience Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Skin Cancer Lymphatic System Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Amphiregulin-associated protein ;ARAPMidgestation and kidney proteinNeurite outgrowth-promoting factor 2Neurite outgrowth-promoting protein
Available
Research Areas	Developmental Biology
Uniprot ID	P21741
Gene Names	MDK
Organism	Homo sapiens (Human)
AA Sequence	VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVG FREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFEN WGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKP CTPKTKAKAKAKKGKGKD
Expression Region	21-143aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	40.4 kDa
Alternative Name(s)	Amphiregulin-associated protein ; ARAPMidgestation and kidney proteinNeurite outgrowth-promoting factor 2Neurite outgrowth-promoting protein
Relevance	Developmentally regulated, secreted growth factor homologous to pleiotrophin (PTN), which has heparin binding activity. Binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1), followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase, and the induction of cell proliferation. Involved in neointima formation after arterial injury, possibly by mediating leukocyte recruitment. Also involved in early fetal adrenal gland development .
Reference	Abnormal expression, highly efficient detection and novel truncations of midkine in human tumors, cancers and cell lines.Tao P., Xu D., Lin S., Ouyang G.L., Chang Y., Chen Q., Yuan Y., Zhuo X., Luo Q., Li J., Li B., Ruan L., Li Q., Li Z.Cancer Lett. 253:60-67(2007)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Developmentally regulated, secreted growth factor homologous to pleiotrophin (PTN), which has heparin binding activity. Binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1), followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase, and the induction of cell proliferation. Involved in neointima formation after arterial injury, possibly by mediating leukocyte recruitment. Also involved in early fetal adrenal gland development (By similarity).
Subcellular Location	Secreted
Protein Families	Pleiotrophin family
Tissue Specificity	Expressed in various tumor cell lines. In insulinoma tissue predominantly expressed in precancerous lesions.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time