Item no. |
CSB-RP098174h-10 |
Manufacturer |
Cusabio
|
Amount |
10ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Acidic-type mitochondrial creatine kinase ;Mia-CKUbiquitous mitochondrial creatine kinase ;U-MtCK |
Available |
|
Research Topic |
Signal Transduction |
Uniprot ID |
P12532 |
Gene Names |
CKMT1A |
Organism |
Homo sapiens (Human) |
AA Sequence |
ASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYAR LCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVA GDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDL DASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPAC TRAERREVERVVVDALSGLKGDLAGRYYRLSEMTE AEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARG IWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFE RFCRGLKEVERLIQERGWEFMWNERLGYILTCPSN LGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRG TGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDG VNYLIDCERRLERGQDIRIPTPVIHTKH |
Expression Region |
40-417aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
47.1 kDa |
Alternative Name(s) |
Acidic-type mitochondrial creatine kinase ; Mia-CKUbiquitous mitochondrial creatine kinase ; U-MtCK |
Relevance |
Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy dands, such as skeletal muscle, heart, brain and spermatozoa. |
Reference |
Isolation and characterization of the gene and cDNA encoding human mitochondrial creatine kinase.Haas R.C., Korenfeld C., Zhang Z., Perryman B., Roman D., Strauss A.W.J. Biol. Chem. 264:2890-2897(1989) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. |
Subcellular Location |
Mitochondrion inner membrane, Peripheral membrane protein, Intermembrane side |
Protein Families |
ATP:guanido phosphotransferase family |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.