Item no. |
CSB-RP065544h-10 |
Manufacturer |
Cusabio
|
Amount |
10ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Host |
E.coli |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Mechano growth factor ;MGFSomatomedin-C |
Available |
|
Alternative Name(s) |
Mechano growth factor ; MGFSomatomedin-C |
AA Sequence |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSS RRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
Research Topic |
Signal Transduction |
Uniprot ID |
P05019 |
Gene Names |
IGF1 |
Tag Info |
N-terminal GST-tagged |
Expression Region |
49-118aa |
MW of Fusion Proten |
34, 7 |
Sequence Info |
Full Length |
Relevance |
The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. |
Reference |
Characterization of insulin-like growth factor 1 in human primary brain tumors.Sandberg-Nordqvist A.-C., Staehlbom P.-A., Reinecke M., Collins V.P., von Holst H., Sara V.Cancer Res. 53:2475-2478(1993) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Species |
Homo sapiens (Human) |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.