Item no. |
CSB-RP053444h-200 |
Manufacturer |
Cusabio
|
Amount |
200ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Conjugate/Tag |
GST |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Endoplasmic reticulum resident protein 28 ;ERp28Endoplasmic reticulum resident protein 31 ;ERp31 |
Available |
|
Research areas |
Signal Transduction |
Target / Protein |
ERP29 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P30040 |
AA Sequence |
PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFK RLAENSASSDDLLVAEVGISDYGDKLNMELSEKYK LDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRW LKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQA LLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGE DFPASEMTRIARLIEKNKMSDGKKEELQKSLNILT AF |
Tag Info |
N-terminal GST-tagged |
Expression Region |
40-251aa |
Protein length |
Partial |
MW |
51.0 kDa |
Alternative Name(s) |
Endoplasmic reticulum resident protein 28 ; ERp28Endoplasmic reticulum resident protein 31 ; ERp31 |
Relevance |
Does not se to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER. |
References |
ERp28, a human endoplasmic-reticulum-lumenal protein, is a member of the protein disulfide isomerase family but lacks a CXXC thioredoxin-box motif.Ferrari D.M., van Nguyen P., Kratzin H.D., Soeling H.D.Eur. J. Biochem. 255:570-579(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER. |
Subcellular Location |
Endoplasmic reticulum lumen, Melanosome |
Tissue Specificity |
Ubiquitous. Mostly expressed in secretory tissues. |
Paythway |
Proteinprocessinginendoplasmicreticulum |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.